Augusta county recently booked Oct 22, 2024 · MICHAEL MCKINLEY PRITT was booked on 10/22/2024 in Augusta County, Virginia. With a few simple clicks, filter by state and/or county, or even search by name or arrest charge! Each county is updated daily and new areas are being added constantly! Jul 24, 2024 · GLENN FRANKLIN TUNING was booked on 7/24/2024 in Augusta County, Virginia. To search and filter the Mugshots for Augusta County, Virginia simply click on the at the top of the page. Nov 15, 2024 · MORGAN FRANCES GARDNER was booked on 11/15/2024 in Augusta County, Virginia. Jan 8, 2025 · KENNETH LLOYD RICKARD was booked on 1/8/2025 in Augusta County, Virginia. Dec 5, 2024 · KARYN MARIE KING was booked on 12/5/2024 in Augusta County, Virginia. Oct 28, 2024 · ABNER NASH JOHNSTON was booked on 10/28/2024 in Augusta County, Virginia. She was charged with CONTEMPT OF COURT Disobedience/resistance of an officer of the court Apr 24, 2024 · JOSEPH EMMANUEL TRUST was booked on 4/24/2024 in Augusta County, Virginia. He was 37 years old on the day of the booking. , or released on summons. Content is public domain and is compiled from public records. She was charged with TRAFFIC - DRIVING WHILE INTOXICATED First conviction, blood alcohol level . S. | Recently Booked | Arrest Mugshot | Jail Booking 2 days ago · Aiken County is a county in the U. Aiken County is a part of the Augusta-Richmond County, GA-SC Metropolitan Statistical Area. Jan 4, 2025 · JOSHUA ANTHONY HINOJOS GRADO was booked on 1/4/2025 in Augusta County, Virginia. He was 27 years old on the day of the booking. Apr 29, 2024 · JUSTIN KEITH ZIMMERMAN was booked on 4/29/2024 in Augusta County, Virginia. He was charged with ASSAULT Stab, cut, wound w/malicious intent victim perm. He was 25 years old on the day of the booking. He was charged with SEXUAL ASSAULT Victim under age 13. She was 50 years old on the day of the booking. He was 64 years old on the day of the booking. Mar 12, 2025 · LAJETTA ALLEN was booked on 3/12/2025 in Augusta County, Virginia. | Recently Booked | Arrest Mugshot | Jail Booking Dec 2, 2024 · Bookings, Arrests and Mugshots in Augusta County, Virginia. 3 days ago · An archive of every person arrested and booked into the Richmond County Jail in Richmond County, Georgia. Bookings are updated several times a day so check back often! Oct 22, 2024 · MICHAEL MCKINLEY PRITT was booked on 10/22/2024 in Augusta County, Virginia. | Recently Booked | Arrest Mugshot | Jail Booking 5 days ago · Explore recent mugshots, arrests, and bookings in Virginia. | Recently Booked | Arrest Mugshot | Jail Booking 3 NEW BOOKINGS/MUGSHOTS WERE ADDED TO AUGUSTA COUNTY ON 2/20/2025 (please note that these numbers may change since new bookings are sometimes added Jan 28, 2025 · ERIC THOMAS YOUNG was booked on 1/28/2025 in Augusta County, Virginia. | Recently Booked | Arrest Mugshot | Jail Booking Feb 3, 2025 · VINCENT EDWARD FLORES was booked in Augusta County, Virginia for TRAFFIC - RECKLESS DRIVING Disregard police command to stop, endangerment. He was 56 years old on the day of the booking. r s t o o d p e n S 9 0 0 3 m a 2 u 1 g g c c 7 r 9 1 a 2 2 i 10 NEW BOOKINGS/MUGSHOTS WERE ADDED TO AUGUSTA COUNTY ON 3 Jul 24, 2024 · GLENN FRANKLIN TUNING was booked on 7/24/2024 in Augusta County, Virginia. She was charged with CONTEMPT OF COURT Fail to appear after charged w/ felony/misd. | Recently Booked | Arrest Mugshot | Jail Booking Jan 15, 2025 · AMANDA LYNN HELON was booked on 1/15/2025 in Augusta County, Virginia. Mar 15, 2025 · DONNA HAWKE was booked on 3/15/2025 in Augusta County, Virginia. Dec 28, 2024 · Augusta County Virginia Recently Booked 20h 2 NEW BOOKINGS/MUGSHOTS WERE ADDED TO AUGUSTA COUNTY ON 4/27/2025 (please note that these numbers may change since new bookings are sometimes added later than this post) https://recentlybooked. You can view reports of daily, monthly, weekly arrests made through this tool. com/VA/Augusta/?Day=1/17/2025 6 days ago · Information posted on this website is provided for informational purposes only, and is subject to change and may be updated periodically. He was charged with TRAFFIC - RECKLESS DRIVING Endanger life or limb. He was 59 years old on the day of the booking. Feb 23, 2025 · ALYSON PAIGE DESPER was booked in Augusta County, Virginia for NARCOTICS Sell, distribute, etc. Results also include Booking Id, Charges, Booking Date, Location, Bond, Reporting Agency, Gender, Age, Crime Date etc. 6 days ago · Explore recent mugshots, arrests, and bookings in Augusta County, Virginia. She was 42 years old on the day of the booking. Easily search the latest arrests and see their mugshots in your local area. This is the booking process and how to find a recently booked offender. | Recently Booked | Arrest Mugshot | Jail Booking Feb 5, 2025 · WALLACE ANDREW BACK was booked on 2/5/2025 in Augusta County, Virginia. r s t o o d p e n S 9 0 0 3 m a 2 u 1 g g c c 7 r 9 1 a 2 2 i 10 NEW BOOKINGS/MUGSHOTS WERE ADDED TO AUGUSTA COUNTY ON 3 Feb 24, 2025 · BRIAN KEITH KARICOFE was booked on 2/24/2025 in Augusta County, Virginia. Its county seat and largest community is Aiken. Jan 21, 2024 · AUSTIN WADE EAVEY was booked on 1/21/2024 in Augusta County, Virginia. He was 49 years old on the day of the booking. , imitation Schedule I/II drug. Feb 26, 2025 · Bookings, Arrests and Mugshots in Augusta County, Virginia. Booking Date: 3/27/2025 11:04:00 PM Age: 21 Apr 20, 2025 · In Virginia, independent cities are separate jurisdictions from the counties that surround them, so the government offices of Augusta County are in Verona, which is contiguous to Staunton. Booking Date: 2/3/2025 4:55:00 PM Age: 18 Feb 5, 2025 · WALLACE ANDREW BACK was booked on 2/5/2025 in Augusta County, Virginia. He was 42 years old on the day of the booking. 2-456 FAIL TO APPEAR (BEGINS 7/1/2019). He was 70 years old on the day of the booking. Stay informed about local law enforcement activities and access up-to-date booking information. | Recently Booked | Arrest Mugshot | Jail Booking Mar 17, 2024 · CYNTHIA CURRY was booked on 3/17/2024 in Augusta County, Virginia. She was 64 years old on the day of the booking. Every effort is made to keep the information provided through this Online Inmate Inquiry application accurate and up-to-date. Nov 6, 2024 · HECTOR RAFAEL QUINTANA RIVERA was booked on 11/6/2024 in Augusta County, Virginia. Aug 1, 2024 · NOAH PARKER TURNAGE was booked on 8/1/2024 in Augusta County, Virginia. Booking Date: 2/23/2025 12:44:00 PM Age: 25 Feb 26, 2025 · MICHAEL STONE AGNOR was booked on 2/26/2025 in Augusta County, Virginia. He was 60 years old on the day of the booking. He was charged with SUPERVISION VIOLATION Probation violation - Felony. 20. com/VA/Augusta/?Day=4/27/2025 6 new bookings/mugshots were added to augusta county on 1/17/2025 (please note that these numbers may change since new bookings are sometimes added later than this post) https://recentlybooked. He was 40 years old on the day of the booking. She was 52 years old on the day of the booking. Bookings are updated several times a day so check bac 6 days ago · Explore recent mugshots, arrests, and bookings in Augusta County, Virginia. The weekly turnover rate of inmates is approximately 55%, meaning that every week more than half of these inmates are released and then replaced with new offenders being Jun 29, 2024 · THOMAS CALVIN INGRAM was booked on 6/29/2024 in Augusta County, Virginia. He was 19 years old on the day of the booking. She was charged with BAIL Violation of conditions of release, pretrial release. . Mar 27, 2025 · ALVARO ALVAREZ LUNA was booked in Augusta County, Virginia for CONTEMPT OF COURT Fail to appear after charged w/ felony/misd. Recently Booked - View Mugshots In Your Local Area. She was 46 years old on the day of the booking. He was 26 years old on the day of the booking. 15 to . As of the 2020 census, its population was 168,808. She was 37 years old on the day of the booking. May 26, 2024 · RONALD KENNETH ONEIL was booked on 5/26/2024 in Augusta County, Virginia. | Recently Booked | Arrest Mugshot | Jail Booking Feb 14, 2025 · SARAH MICHELE BACON was booked on 2/14/2025 in Augusta County, Virginia. Find Inmate rosters, recent arrests, mugshots of offenders in Augusta County, Virginia. After an arrest in Augusta County, offenders are brought to the Middle River Regional Jail and booked. He was 39 years old on the day of the booking. Every year Augusta County law enforcement agencies arrest and detain 18,780 offenders, and maintain an average of 939 inmates (county-wide) in their custody on any given day. state of South Carolina. Nov 4, 2024 · AUSTIN WILLIAM DAVIS was booked on 11/4/2024 in Augusta County, Virginia. He was 52 years old on the day of the booking. Jul 2, 2024 · ROBIN ALLEN STOVER was booked on 7/2/2024 in Augusta County, Virginia. | Recently Booked | Arrest Mugshot | Jail Booking The City of Augusta and the Richmond County Sheriff’s Office provide access to current inmate information as a service to the general public. Any jail bookings before February of 2020 will not be included. 2 days ago · Explore recent mugshots, arrests, and bookings in Maine. Bookings are updated several times a day so check bac Augusta County Virginia Recently Booked. | Recently Booked | Arrest Mugshot | Jail Booking Aug 19, 2023 · MONTANA SIERRA-SKY PETERS was booked in Augusta County, Virginia for 18. Booking Details name BROWN, KEITH ORLANDO age 39 years old height 5′ 8″ hair BLACK eye BROWN weight 240 lbs race BLACK sex Male arrested by AUGUSTA booked 2025-04-29 Charges… Read More Middle River When this happens, it's usually because the owner only shared it with a small group of people, changed who can see it or it's been deleted. He was charged with ROBBERY Robbery by using firearm or displaying a firearm. | Recently Booked | Arrest Mugshot | Jail Booking Augusta County Virginia Recently Booked. She was 39 years old on the day of the booking. Feb 11, 2025 · Middle River Regional Jail (MRRJ) was built to alleviate the increasing jail population at the former Augusta County Jail, Staunton, VA. May 1, 2024 · ADAM ROSS CUNNINGHAM was booked on 5/1/2024 in Augusta County, Virginia. Mar 1, 2025 · RICHARD EUGENE VANCE was booked on 3/1/2025 in Augusta County, Virginia. impaired. Includes Augusta, Blythe, Hephzibah, Fort Gordon, and all surrounding areas served by the Richmond County Sheriff’s Office. Aug 27, 2024 · CHRISTINE YVONNE FITZGERALD was booked on 8/27/2024 in Augusta County, Virginia. Staunton is a principal city of the Staunton-Waynesboro Metropolitan Statistical Area, which had a 2010 population of 118,502. | Recently Booked | Arrest Mugshot | Jail Booking Find Inmate rosters, recent arrests, mugshots of offenders made by Augusta County Sheriff's Dept. Booking Number: 23-02351 Booking Date: 8/19/2023 3 NEW BOOKINGS/MUGSHOTS WERE ADDED TO AUGUSTA COUNTY ON 2/20/2025 (please note that these numbers may change since new bookings are sometimes added Jan 28, 2025 · ERIC THOMAS YOUNG was booked on 1/28/2025 in Augusta County, Virginia. | Recently Booked | Arrest Mugshot | Jail Booking Aug 28, 2024 · STEPHEN GEORGE RUSIECKI was booked on 8/28/2024 in Augusta County, Virginia. . 5 days ago · Explore recent mugshots, arrests, and bookings in Augusta County, Virginia. MRRJ enabled inmates that were formerly being held in other facilities due to overcrowding to return to their local jurisdiction. He was 61 years old on the day of the booking. mmfewklgcyrpahcvwrlretdtedfdikenfieokivnqgrpqjksswatbrnrrqnmdnklfqtg